PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000552812
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 124aa    MW: 13934.9 Da    PI: 10.4126
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000552812genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM107.51.6e-332810154128
            NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                    + kewyf+s+rd+kyatg r+nrat++gyWkatgkd+++l+ +g+lvg++ktLvfy+grapkg+k+dWvmhe+r+
  MDP0000552812  28 GGKEWYFYSQRDRKYATGLRTNRATATGYWKATGKDRPILR-RGSLVGMRKTLVFYQGRAPKGRKSDWVMHEFRV 101
                    679*************************************9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100533.3881123IPR003441NAC domain
PfamPF023651.7E-1520101IPR003441NAC domain
SuperFamilySSF1019412.62E-3423106IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MDDDESPPFA FLSPCAGYQE VFESACVGGK EWYFYSQRDR KYATGLRTNR ATATGYWKAT  60
GKDRPILRRG SLVGMRKTLV FYQGRAPKGR KSDWVMHEFR VEGPLGPPKI SSLKHSARIL  120
KGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-292310162140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.1551e-146leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981231e-98KF198123.1 Malus hupehensis NAC domain protein (NAC88) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009336675.13e-61PREDICTED: NAC domain-containing protein 21/22-like
RefseqXP_009361751.13e-61PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE64e-51NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM5WHT73e-57M5WHT7_PRUPE; Uncharacterized protein
STRINGGLYMA08G18470.12e-54(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100103241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.12e-52NAC domain containing protein 1